Anti-EIF4E pAb
RIP-CERTIFIED ANTIBODY:
Posttranscriptional regulation of gene expression is a ribonucleoprotein-driven process, which involves RNA binding proteins (RBPs) and non-coding RNAs that affect splicing, nuclear export, subcellular localization, mRNA decay and translation. The RNP Immunoprecipitation-Chip (RIP-Chip), RIP-Seq and RIP-RTPCR allow the identification of multiple RNA targets of RBPs globally and within the context of a cell extract. Antibodies specific to the RNA binding protein of interest are used to co-immunoprecipitate the RNA binding protein and the associated subset of mRNAs. The mRNA content is interrogated using standard microarray or sequencing technology. RIP-Certified Antibody is validated for use in RNP Immunoprecipitation (RIP) in conjunction with the RIP-Assay Kit distributed from MBL. Its ability to immunoprecipitate mRNAs and RBPs complex was confirmed by quantitative and qualitative analysis on NanoDrop, Bioanalyzer and RT-PCR or microarray.
| Target | EIF4E |
|---|---|
| Product Type | Antibody |
| Application | IC, IP, RIP, WB |
| Clonality | Polyclonal |
| Conjugate | Unlabeled |
| Isotype | Affinity Purified Ig |
| Immunogen | KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.) |
| Host Species | Rabbit |
| Species Reactivity | Human, Hamster, Mouse, Rat |
| Formulation | 200 μl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained. |
| Research Area | Cancer, Epigenetics, RNA-RNP Network |
| Description/Background | The eukaryotic initiation factor 4E (eIF4E) is a key regulatory component that anchors the mRNA cap-binding complex (eIF4F) to the 5’ end of capped mRNAs. eIF3, the poly (A)-binding protein, and the eIF4 proteins recruit mRNA to the 43S initiation complex to form the 48S initiation complex. The eIF4 proteins consist of eIF4A; RNA helicase (46 kDa), eIF4B; RNA binding and RNA annealing protein (70 kDa), eIF4E (25 kDa); cap binding protein, eIF4H; work with eIF4B to stimulate eIF4A helicase activity (25 kDa), and eIF4G; co-localize all other proteins necessary for mRNA recruitment on the 40S subunit. As a principal initiation factor, eIF4E has the potential to influence expression of every protein in the cell. mRNA subset associated with eIF4E in p19 cell differed from mRNA subset associated with HuB or poly A binding protein, suggested that they reflect distinct functional subset of mRNAs whose expression is regulated differently at the level of translation. |
| Storage Temperature | This antibody solution is stable for one year from the date of purchase when stored at -20°C. |
| Protocols | IC, IP, RIP, WB |
| Source | This antibody was purified from rabbit serum by affinity column chromatography. The rabbit was immunized with KLH conjugated synthetic peptide, MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH corresponding to 1-37 aa. |
| Regulatory Statement | For Research Use Only. Not for use in diagnostic procedures. |
